PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do008033.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family SBP
Protein Properties Length: 332aa    MW: 36296.8 Da    PI: 8.7264
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do008033.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.41.1e-3960137178
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 +CqvegC  +l +akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsrfh lsefD++krsCrrrL++hn+rrrk+q+
  Do008033.1  60 RCQVEGCGLELGTAKEYHRKHRVCEAHTKCPRVVVAGQERRFCQQCSRFHGLSEFDQKKRSCRRRLSDHNARRRKPQP 137
                 6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-3254122IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.60758135IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.41E-3859140IPR004333Transcription factor, SBP-box
PfamPF031102.8E-3061134IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MEWTAPKPAA SPSSPPLLWD WGDHAAAGSG SSGDAPARRG GREREGKRAK GEEGGGAEVR  60
CQVEGCGLEL GTAKEYHRKH RVCEAHTKCP RVVVAGQERR FCQQCSRFHG LSEFDQKKRS  120
CRRRLSDHNA RRRKPQPDVF PFAPASLPSS LFEDRRQISF VWNKAPLSHV RPFTPPWDSS  180
SDFKLPHAKE IRELSTKVGT ITGQVHFDKS HLSNAIPTLG HGKDELLPMK GLNTSMTASK  240
FDGAPDLQRA LSLLSAGSCG LPDPVQQASC LIQFTGASEK SGDLHLSHGG NSVPASCADE  300
QHIAPQPQLV RFTMDTSSNV YEPTFFGVNQ IN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-2551134184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116133KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0334150.0BT033415.1 Zea mays full-length cDNA clone ZM_BFb0223G18 mRNA, complete cds.
GenBankBT0875080.0BT087508.1 Zea mays full-length cDNA clone ZM_BFb0098L17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951747.10.0PREDICTED: squamosa promoter-binding-like protein 4
SwissprotQ653Z51e-102SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLK3YU030.0K3YU03_SETIT; Uncharacterized protein
STRINGSi017749m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.45e-44squamosa promoter binding protein-like 10